Lineage for d1k4ya_ (1k4y A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184304Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 184305Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families) (S)
  5. 184306Family c.69.1.1: Acetylcholinesterase-like [53475] (4 protein domains)
  6. 184371Protein Mammalian carboxylesterase [75282] (1 species)
  7. 184372Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75283] (1 PDB entry)
  8. 184373Domain d1k4ya_: 1k4y A: [72069]

Details for d1k4ya_

PDB Entry: 1k4y (more details), 2.5 Å

PDB Description: Crystal Structure of Rabbit Liver Carboxylesterase in Complex with 4-piperidino-piperidine

SCOP Domain Sequences for d1k4ya_:

Sequence, based on SEQRES records: (download)

>d1k4ya_ c.69.1.1 (A:) Mammalian carboxylesterase {Rabbit (Oryctolagus cuniculus)}
ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
dgvllpkapaeilaekkynmlpymvginqqefgwiipmqmlgyplsegkldqktatellw
ksypivnvskeltpvatekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagap
tymyeyryrpsfssdmrpktvigdhgdeifsvlgapflkegateeeiklskmvmkywanf
arngnpngeglpqwpaydykegylqigattqaaqklkdkevafwtelwakeaar

Sequence, based on observed residues (ATOM records): (download)

>d1k4ya_ c.69.1.1 (A:) Mammalian carboxylesterase {Rabbit (Oryctolagus cuniculus)}
ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
dgvllpkapaeilaekkynmlpymvginqqefkldqktatellwksypivnvskeltpva
tekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagaptymyeyrhgdeifsvl
gapflkegateeeiklskmvmkywanfarngnpngeglpqwpaydykegylqigattqaa
qklkdkevafwtelwakeaar

SCOP Domain Coordinates for d1k4ya_:

Click to download the PDB-style file with coordinates for d1k4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1k4ya_: