Lineage for d1k4wa_ (1k4w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728860Protein Orphan nuclear receptor ROR-beta [74794] (1 species)
  7. 2728861Species Norway rat (Rattus norvegicus) [TaxId:10116] [74795] (3 PDB entries)
  8. 2728863Domain d1k4wa_: 1k4w A: [72068]
    complexed with ste

Details for d1k4wa_

PDB Entry: 1k4w (more details), 1.9 Å

PDB Description: x-ray structure of the orphan nuclear receptor ror beta ligand-binding domain in the active conformation
PDB Compounds: (A:) Nuclear receptor ROR-beta

SCOPe Domain Sequences for d1k4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4wa_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tmseidriaqniikshletcqytmeelhqlawqthtyeeikayqsksrealwqqcaiqit
haiqyvvefakritgfmelcqndqilllksgclevvlvrmcrafnplnntvlfegkyggm
qmfkalgsddlvneafdfaknlcslqlteeeialfssavlispdrawlleprkvqklqek
iyfalqhviqknhlddetlakliakiptitavcnlhgeklqvfkqshpdivntlfpplyk
elfn

SCOPe Domain Coordinates for d1k4wa_:

Click to download the PDB-style file with coordinates for d1k4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1k4wa_: