SCOPe 2.06: Domain d1k47c2: 1k47 C:195-329

Lineage for d1k47c2 (1k47 C:195-329)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (2 proteins)

6. Protein Phosphomevalonate kinase (PMK) [75455] (1 species)

7. Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (2 PDB entries)

8. Domain d1k47c2: 1k47 C:195-329 [72045]
   Other proteins in same PDB: d1k47a1, d1k47a3, d1k47b1, d1k47b3, d1k47c1, d1k47c3, d1k47d1, d1k47d3, d1k47e1, d1k47e3, d1k47f1, d1k47f3

Details for d1k47c2

PDB Entry: 1k47, 2.42 Å

PDB Description: crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)

PDB Compounds: (C:) phosphomevalonate kinase

SCOPe Domain Sequences for d1k47c2:

Sequence; same for both SEQRES and ATOM records:

>d1k47c2 d.58.26.4 (C:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]}
kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq
vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn
rwadlgiellyqeri

Timeline for d1k47c2:

• d1k47c2 first appeared in SCOP 1.61
  
• d1k47c2 appears in SCOPe 2.05
  
• d1k47c2 appears in SCOPe 2.07
  
• d1k47c2 appears in the current release, SCOPe 2.08