Lineage for d1k2pa_ (1k2p A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734765Protein Bruton's tyrosine kinase (Btk) [75564] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 734766Species Human (Homo sapiens) [TaxId:9606] [75565] (1 PDB entry)
  8. 734767Domain d1k2pa_: 1k2p A: [72012]

Details for d1k2pa_

PDB Entry: 1k2p (more details), 2.1 Å

PDB Description: Crystal structure of Bruton's tyrosine kinase domain
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOP Domain Sequences for d1k2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}
idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
kaderptfkillsnildv

SCOP Domain Coordinates for d1k2pa_:

Click to download the PDB-style file with coordinates for d1k2pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k2pb_