SCOP 1.73: Domain d1k2ba_: 1k2b A:

Lineage for d1k2ba_ (1k2b A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)

8. Domain d1k2ba_: 1k2b A: [72006]

Details for d1k2ba_

PDB Entry: 1k2b, 1.7 Å

PDB Description: combining mutations in hiv-1 protease to understand mechanisms of resistance

PDB Compounds: (A:) protease retropepsin

SCOP Domain Sequences for d1k2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1k2ba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrdlmtqigatlnf

Timeline for d1k2ba_:

• d1k2ba_ first appeared in SCOP 1.61
  
• d1k2ba_ appears in SCOP 1.71
  
• d1k2ba_ appears in SCOP 1.75
  
• d1k2ba_ appears in the current release, SCOPe 2.08