Lineage for d1jymh_ (1jym H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606932Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 2606952Domain d1jymh_: 1jym H: [71964]
    Other proteins in same PDB: d1jyma2, d1jymb2, d1jyme2
    complexed with co

Details for d1jymh_

PDB Entry: 1jym (more details), 2.8 Å

PDB Description: Crystals of Peptide Deformylase from Plasmodium falciparum with Ten Subunits per Asymmetric Unit Reveal Critical Characteristics of the Active Site for Drug Design
PDB Compounds: (H:) Peptide deformylase

SCOPe Domain Sequences for d1jymh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jymh_ d.167.1.1 (H:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
eikivkypdpilrrrsevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwna
lyekrkeenerifinpsiveqslvklkliegclsfgiegkverpsivsisyydingykhl
kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathsee

SCOPe Domain Coordinates for d1jymh_:

Click to download the PDB-style file with coordinates for d1jymh_.
(The format of our PDB-style files is described here.)

Timeline for d1jymh_: