Lineage for d1jymg_ (1jym G:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614180Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 614181Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 614182Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 614183Protein Peptide deformylase [56422] (9 species)
  7. 614225Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 614244Domain d1jymg_: 1jym G: [71963]

Details for d1jymg_

PDB Entry: 1jym (more details), 2.8 Å

PDB Description: Crystals of Peptide Deformylase from Plasmodium falciparum with Ten Subunits per Asymmetric Unit Reveal Critical Characteristics of the Active Site for Drug Design

SCOP Domain Sequences for d1jymg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jymg_ d.167.1.1 (G:) Peptide deformylase {Malaria parasite (Plasmodium falciparum)}
deikivkypdpilrrrsevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwn
alyekrkeenerifinpsiveqslvklkliegclsfgiegkverpsivsisyydingykh
lkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykaths

SCOP Domain Coordinates for d1jymg_:

Click to download the PDB-style file with coordinates for d1jymg_.
(The format of our PDB-style files is described here.)

Timeline for d1jymg_: