Lineage for d1jyme1 (1jym E:63-237)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3000945Protein Peptide deformylase [56422] (11 species)
  7. 3001008Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 3001025Domain d1jyme1: 1jym E:63-237 [71961]
    Other proteins in same PDB: d1jyma2, d1jymb2, d1jyme2
    complexed with co

Details for d1jyme1

PDB Entry: 1jym (more details), 2.8 Å

PDB Description: Crystals of Peptide Deformylase from Plasmodium falciparum with Ten Subunits per Asymmetric Unit Reveal Critical Characteristics of the Active Site for Drug Design
PDB Compounds: (E:) Peptide deformylase

SCOPe Domain Sequences for d1jyme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyme1 d.167.1.1 (E:63-237) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
deikivkypdpilrrrsevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwn
alyekrkeenerifinpsiveqslvklkliegclsfgiegkverpsivsisyydingykh
lkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseep

SCOPe Domain Coordinates for d1jyme1:

Click to download the PDB-style file with coordinates for d1jyme1.
(The format of our PDB-style files is described here.)

Timeline for d1jyme1: