Lineage for d1jwxa1 (1jwx A:2-235)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily) Superfamily c.95.1: Thiolase-like [53901] (2 families) 
Family c.95.1.2: Chalcone synthase [53914] (2 proteins) Protein Chalcone synthase [53915] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (14 PDB entries) 
Domain d1jwxa1: 1jwx A:2-235 [71920]
Details for d1jwxa1
PDB Entry: 1jwx (more details), 1.63 Å
PDB Description: chalcone synthase--f215s mutant
SCOP Domain Sequences for d1jwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwxa1 c.95.1.2 (A:2-235) Chalcone synthase {Alfalfa (Medicago sativa)}
vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaenn
kgarvlvvcsevtavtfrgpsdthldslvgqalsgdgaaalivgsdpvpeiekp
SCOP Domain Coordinates for d1jwxa1:
Click to download the PDB-style file with coordinates for d1jwxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jwxa1:
- d1jwxa1 is new in SCOP 1.61
- d1jwxa1 appears in SCOP 1.63
- d1jwxa1 appears in the current release, SCOPe 2.08
View in 3D
