SCOPe 2.02: Domain d1jwhb_: 1jwh B:

Lineage for d1jwhb_ (1jwh B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (29 PDB entries)

8. Domain d1jwhb_: 1jwh B: [71914]
   Other proteins in same PDB: d1jwhc_, d1jwhd_
   complexed with anp, po4, zn

Details for d1jwhb_

PDB Entry: 1jwh, 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme

PDB Compounds: (B:) casein kinase II, alpha chain

SCOPe Domain Sequences for d1jwhb_:

Sequence; same for both SEQRES and ATOM records:

>d1jwhb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmgs

Timeline for d1jwhb_:

• d1jwhb_ first appeared in SCOP 1.61
  
• d1jwhb_ appears in SCOPe 2.01
  
• d1jwhb_ appears in SCOPe 2.03
  
• d1jwhb_ appears in the current release, SCOPe 2.08