Lineage for d1jwhb_ (1jwh B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875082Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 875083Species Human (Homo sapiens) [TaxId:9606] [75559] (4 PDB entries)
  8. 875088Domain d1jwhb_: 1jwh B: [71914]
    Other proteins in same PDB: d1jwhc_, d1jwhd_
    complexed with anp, po4, zn

Details for d1jwhb_

PDB Entry: 1jwh (more details), 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme
PDB Compounds: (B:) casein kinase II, alpha chain

SCOP Domain Sequences for d1jwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwhb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmgs

SCOP Domain Coordinates for d1jwhb_:

Click to download the PDB-style file with coordinates for d1jwhb_.
(The format of our PDB-style files is described here.)

Timeline for d1jwhb_: