Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75559] (34 PDB entries) |
Domain d1jwha_: 1jwh A: [71913] Other proteins in same PDB: d1jwhc_, d1jwhd_ complexed with anp, po4, zn |
PDB Entry: 1jwh (more details), 3.1 Å
SCOPe Domain Sequences for d1jwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]} sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl dkllrydhqsrltareamehpyfytvvkdqarmgss
Timeline for d1jwha_: