Lineage for d1jwha_ (1jwh A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435282Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1435283Species Human (Homo sapiens) [TaxId:9606] [75559] (34 PDB entries)
  8. 1435325Domain d1jwha_: 1jwh A: [71913]
    Other proteins in same PDB: d1jwhc_, d1jwhd_
    complexed with anp, po4, zn

Details for d1jwha_

PDB Entry: 1jwh (more details), 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme
PDB Compounds: (A:) casein kinase II, alpha chain

SCOPe Domain Sequences for d1jwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmgss

SCOPe Domain Coordinates for d1jwha_:

Click to download the PDB-style file with coordinates for d1jwha_.
(The format of our PDB-style files is described here.)

Timeline for d1jwha_: