| Class b: All beta proteins [48724] (111 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
| Species Amyloidogenic lambda L chain BUR (human) [74837] (1 PDB entry) |
| Domain d1jvkb2: 1jvk B:113-215 [71900] Other proteins in same PDB: d1jvka1, d1jvkb1 |
PDB Entry: 1jvk (more details), 1.94 Å
SCOP Domain Sequences for d1jvkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvkb2 b.1.1.2 (B:113-215) Immunoglobulin (constant domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapta
Timeline for d1jvkb2: