SCOP 1.61: Domain d1jvkb1: 1jvk B:1-112

Lineage for d1jvkb1 (1jvk B:1-112)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Amyloidogenic lambda L chain BUR (human) [74825] (1 PDB entry)

8. Domain d1jvkb1: 1jvk B:1-112 [71899]
   Other proteins in same PDB: d1jvka2, d1jvkb2

Details for d1jvkb1

PDB Entry: 1jvk, 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor

SCOP Domain Sequences for d1jvkb1:

Sequence; same for both SEQRES and ATOM records:

>d1jvkb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg

Timeline for d1jvkb1:

• d1jvkb1 is new in SCOP 1.61
  
• d1jvkb1 appears in SCOP 1.63
  
• d1jvkb1 appears in the current release, SCOPe 2.08