Lineage for d1jvka2 (1jvk A:113-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028905Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2028909Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 2028918Domain d1jvka2: 1jvk A:113-216 [71898]
    Other proteins in same PDB: d1jvka1, d1jvkb1
    part of amyloidogenic protein BUR

Details for d1jvka2

PDB Entry: 1jvk (more details), 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor
PDB Compounds: (A:) immunoglobulin lambda light chain

SCOPe Domain Sequences for d1jvka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvka2 b.1.1.2 (A:113-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptac

SCOPe Domain Coordinates for d1jvka2:

Click to download the PDB-style file with coordinates for d1jvka2.
(The format of our PDB-style files is described here.)

Timeline for d1jvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvka1