Lineage for d1jvka2 (1jvk A:113-216)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290008Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries)
  8. 290016Domain d1jvka2: 1jvk A:113-216 [71898]
    Other proteins in same PDB: d1jvka1, d1jvkb1

Details for d1jvka2

PDB Entry: 1jvk (more details), 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor

SCOP Domain Sequences for d1jvka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvka2 b.1.1.2 (A:113-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptac

SCOP Domain Coordinates for d1jvka2:

Click to download the PDB-style file with coordinates for d1jvka2.
(The format of our PDB-style files is described here.)

Timeline for d1jvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvka1