SCOP 1.63: Domain d1jvka1: 1jvk A:1-112

Lineage for d1jvka1 (1jvk A:1-112)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Amyloidogenic lambda L chain BUR (human) [74825] (1 PDB entry)

8. Domain d1jvka1: 1jvk A:1-112 [71897]
   Other proteins in same PDB: d1jvka2, d1jvkb2

Details for d1jvka1

PDB Entry: 1jvk, 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor

SCOP Domain Sequences for d1jvka1:

Sequence; same for both SEQRES and ATOM records:

>d1jvka1 b.1.1.1 (A:1-112) Immunoglobulin (variable domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg

Timeline for d1jvka1:

• d1jvka1 first appeared in SCOP 1.61
  
• d1jvka1 appears in SCOP 1.65
  
• d1jvka1 appears in the current release, SCOPe 2.08