| Class b: All beta proteins [48724] (111 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
| Species Amyloidogenic lambda L chain BUR (human) [74825] (1 PDB entry) |
| Domain d1jvka1: 1jvk A:1-112 [71897] Other proteins in same PDB: d1jvka2, d1jvkb2 |
PDB Entry: 1jvk (more details), 1.94 Å
SCOP Domain Sequences for d1jvka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvka1 b.1.1.1 (A:1-112) Immunoglobulin (variable domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg
Timeline for d1jvka1: