Lineage for d1jtri2 (1jtr I:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190425Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (22 PDB entries)
  8. 190448Domain d1jtri2: 1jtr I:1-181 [71878]
    Other proteins in same PDB: d1jtra1, d1jtra2, d1jtrb1, d1jtrb2, d1jtrc1, d1jtrc2, d1jtrd1, d1jtrd2, d1jtrh1, d1jtri1, d1jtrl1, d1jtrm1

Details for d1jtri2

PDB Entry: 1jtr (more details), 2.4 Å

PDB Description: 2C/H-2Kbm3/dEV8 allogeneic complex

SCOP Domain Sequences for d1jtri2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtri2 d.19.1.1 (I:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1jtri2:

Click to download the PDB-style file with coordinates for d1jtri2.
(The format of our PDB-style files is described here.)

Timeline for d1jtri2:

  • d1jtri2 is new in SCOP 1.61
  • d1jtri2 became obsolete in SCOP 1.63