Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries) |
Domain d1jtri1: 1jtr I:182-274 [71877] Other proteins in same PDB: d1jtra1, d1jtra2, d1jtrb1, d1jtrb2, d1jtrc1, d1jtrc2, d1jtrd1, d1jtrd2, d1jtrh2, d1jtri2 |
PDB Entry: 1jtr (more details), 2.4 Å
SCOP Domain Sequences for d1jtri1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtri1 b.1.1.2 (I:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1jtri1: