Lineage for d1jtri1 (1jtr I:182-274)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 159007Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)
  8. 159051Domain d1jtri1: 1jtr I:182-274 [71877]
    Other proteins in same PDB: d1jtra1, d1jtra2, d1jtrb1, d1jtrb2, d1jtrc1, d1jtrc2, d1jtrd1, d1jtrd2, d1jtrh2, d1jtri2

Details for d1jtri1

PDB Entry: 1jtr (more details), 2.4 Å

PDB Description: 2C/H-2Kbm3/dEV8 allogeneic complex

SCOP Domain Sequences for d1jtri1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtri1 b.1.1.2 (I:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1jtri1:

Click to download the PDB-style file with coordinates for d1jtri1.
(The format of our PDB-style files is described here.)

Timeline for d1jtri1:

  • d1jtri1 is new in SCOP 1.61
  • d1jtri1 became obsolete in SCOP 1.63