Lineage for d1jtrc2 (1jtr C:118-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160265Protein T-cell antigen receptor [49125] (6 species)
  7. 160293Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)
  8. 160296Domain d1jtrc2: 1jtr C:118-213 [71872]
    Other proteins in same PDB: d1jtra1, d1jtrb1, d1jtrc1, d1jtrd1, d1jtrh1, d1jtrh2, d1jtri1, d1jtri2, d1jtrl1, d1jtrm1

Details for d1jtrc2

PDB Entry: 1jtr (more details), 2.4 Å

PDB Description: 2C/H-2Kbm3/dEV8 allogeneic complex

SCOP Domain Sequences for d1jtrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtrc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1jtrc2:

Click to download the PDB-style file with coordinates for d1jtrc2.
(The format of our PDB-style files is described here.)

Timeline for d1jtrc2:

  • d1jtrc2 is new in SCOP 1.61
  • d1jtrc2 became obsolete in SCOP 1.63