Lineage for d1jsxa_ (1jsx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893489Family c.66.1.20: Glucose-inhibited division protein B (GidB) [75264] (1 protein)
    automatically mapped to Pfam PF02527
  6. 2893490Protein Glucose-inhibited division protein B (GidB) [75265] (2 species)
    function unknown
  7. 2893493Species Escherichia coli [TaxId:562] [75266] (1 PDB entry)
  8. 2893494Domain d1jsxa_: 1jsx A: [71846]
    structural genomics

Details for d1jsxa_

PDB Entry: 1jsx (more details), 2.4 Å

PDB Description: crystal structure of the escherichia coli glucose-inhibited division protein b (gidb)
PDB Compounds: (A:) Glucose-inhibited division protein B

SCOPe Domain Sequences for d1jsxa_:

Sequence, based on SEQRES records: (download)

>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]}
mlnklslllkdagisltdhqknqliayvnmlhkwnkaynltsvrdpnemlvrhildsivv
apylqgerfidvgtgpglpgiplsivrpeahftlldslgkrvrflrqvqhelkleniepv
qsrveefpseppfdgvisrafaslndmvswchhlpgeqgrfyalkgqmpedeiallpeey
qvesvvklqvpaldgerhlvvikanki

Sequence, based on observed residues (ATOM records): (download)

>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]}
mlnklslllkdagisltdhqknqliayvnmlhkwnemlvrhildsivvapylqgerfidv
gtgpglpgiplsivrpeahftlldslgkrvrflrqvqhelkleniepvqsrveefpsepp
fdgvisrafaslndmvswchhlpgeqgrfyalkgqmpedeiallpeeyqvesvvklqvpd
gerhlvvikanki

SCOPe Domain Coordinates for d1jsxa_:

Click to download the PDB-style file with coordinates for d1jsxa_.
(The format of our PDB-style files is described here.)

Timeline for d1jsxa_: