SCOP 1.73: Domain d1jspb_: 1jsp B:

Lineage for d1jspb_ (1jsp B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (2 PDB entries)

8. Domain d1jspb_: 1jsp B: [71843]
   complexed with p53 peptide, chain A
   complexed with aly

Details for d1jspb_

PDB Entry: 1jsp

PDB Description: nmr structure of cbp bromodomain in complex with p53 peptide

PDB Compounds: (B:) creb-binding protein

SCOP Domain Sequences for d1jspb_:

Sequence; same for both SEQRES and ATOM records:

>d1jspb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

Timeline for d1jspb_:

• d1jspb_ first appeared in SCOP 1.61
  
• d1jspb_ appears in SCOP 1.71
  
• d1jspb_ appears in SCOP 1.75
  
• d1jspb_ appears in the current release, SCOPe 2.08, called d1jspb1