Lineage for d1jspb_ (1jsp B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.29: Bromodomain-like [47363] (4 superfamilies) Superfamily a.29.2: Bromodomain [47370] (1 family) 
Family a.29.2.1: Bromodomain [47371] (4 proteins) 
Protein CREB-binding protein, CBP [74712] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74713] (1 PDB entry) 
Domain d1jspb_: 1jsp B: [71843]
Details for d1jspb_
PDB Entry: 1jsp (more details)
PDB Description: nmr structure of cbp bromodomain in complex with p53 peptide
SCOP Domain Sequences for d1jspb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jspb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens)}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g
SCOP Domain Coordinates for d1jspb_:
Click to download the PDB-style file with coordinates for d1jspb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jspb_:
- d1jspb_ is new in SCOP 1.61
- d1jspb_ appears in SCOP 1.63
- d1jspb_ appears in the current release, SCOPe 2.08, called d1jspb1
View in 3D