Lineage for d1jrkc1 (1jrk C:1-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971570Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 2971571Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 2971578Domain d1jrkc1: 1jrk C:1-143 [71829]
    Other proteins in same PDB: d1jrka2, d1jrkb2, d1jrkc2, d1jrkd2
    structural genomics
    complexed with mpd

    has additional insertions and/or extensions that are not grouped together

Details for d1jrkc1

PDB Entry: 1jrk (more details), 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets
PDB Compounds: (C:) Nudix homolog

SCOPe Domain Sequences for d1jrkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrkc1 d.113.1.1 (C:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkis

SCOPe Domain Coordinates for d1jrkc1:

Click to download the PDB-style file with coordinates for d1jrkc1.
(The format of our PDB-style files is described here.)

Timeline for d1jrkc1: