SCOPe 2.07: Domain d1jr6a_: 1jr6 A:

Lineage for d1jr6a_ (1jr6 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries)

8. Domain d1jr6a_: 1jr6 A: [71821]
   an engineered arginine-rich subdomain 2

Details for d1jr6a_

PDB Entry: 1jr6

PDB Description: solution structure of an engineered arginine-rich subdomain 2 of the hepatitis c virus ns3 rna helicase

PDB Compounds: (A:) Helicase NS3

SCOPe Domain Sequences for d1jr6a_:

Sequence; same for both SEQRES and ATOM records:

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
gsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalgi
navayyrgldvsviptngdvvvvatdalmtgftgdfdsvidcntsdgkpqdavsrtqrrg
rtgrgkpgiyrfvapger

Timeline for d1jr6a_:

• d1jr6a_ first appeared in SCOP 1.61
  
• d1jr6a_ appears in SCOPe 2.06
  
• d1jr6a_ appears in the current release, SCOPe 2.08