Lineage for d1jr6a_ (1jr6 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.14: RNA helicase [52724] (1 protein) Protein HCV helicase domain [52725] (1 species) Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (5 PDB entries) 
Domain d1jr6a_: 1jr6 A: [71821]
Details for d1jr6a_
PDB Entry: 1jr6 (more details)
PDB Description: solution structure of an engineered arginine-rich subdomain 2 of the hepatitis c virus ns3 rna helicase
SCOP Domain Sequences for d1jr6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
gsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalgi
navayyrgldvsviptngdvvvvatdalmtgftgdfdsvidcntsdgkpqdavsrtqrrg
rtgrgkpgiyrfvapger
SCOP Domain Coordinates for d1jr6a_:
Click to download the PDB-style file with coordinates for d1jr6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jr6a_:
- d1jr6a_ is new in SCOP 1.61
- d1jr6a_ appears in SCOP 1.63
- d1jr6a_ appears in the current release, SCOPe 2.08
View in 3D