Lineage for d1jqyp_ (1jqy P:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166279Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 166337Protein Heat-labile toxin [50205] (2 species)
  7. 166338Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries)
  8. 166418Domain d1jqyp_: 1jqy P: [71809]

Details for d1jqyp_

PDB Entry: 1jqy (more details), 2.14 Å

PDB Description: heat-labile enterotoxin b-pentamer with ligand bmsc-0010

SCOP Domain Sequences for d1jqyp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqyp_ b.40.2.1 (P:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1jqyp_:

Click to download the PDB-style file with coordinates for d1jqyp_.
(The format of our PDB-style files is described here.)

Timeline for d1jqyp_: