SCOPe 2.07: Domain d1jqga1: 1jqg A:1-310

Lineage for d1jqga1 (1jqg A:1-310)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [75247] (1 PDB entry)

8. Domain d1jqga1: 1jqg A:1-310 [71791]
   Other proteins in same PDB: d1jqga2
   complexed with zn

Details for d1jqga1

PDB Entry: 1jqg, 2.5 Å

PDB Description: Crystal Structure of the Carboxypeptidase A from Helicoverpa Armigera

PDB Compounds: (A:) carboxypeptidase a

SCOPe Domain Sequences for d1jqga1:

Sequence; same for both SEQRES and ATOM records:

>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
nstrsrlsfdkihsyeevdaylqelakefpnvvtvveggksfegrsikylristtnfqda
skpvvmmqsllhcrewvtlpatlyaihklvidvtesdlinnidwiilpvanpdgyvhtfg
gdrywrknratgymagnlcmgvdlnrnfgmnwgtassssvcsdtfhgrsafsepessvir
diiaehrnrmalyldihsfgsmilygygngvlpsnalqlhligvqmaqaidrvkwssnkd
yivgnifhvlyaasggasdyamqaaapfsytyelpayrnsvwfdgflvdpdfieqagfet
wegikvgaraaaaaake

Timeline for d1jqga1:

• d1jqga1 first appeared in SCOP 1.61
  
• d1jqga1 appears in SCOPe 2.06
  
• d1jqga1 appears in the current release, SCOPe 2.08