Lineage for d1jnza1 (1jnz A:503-643)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636710Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 636711Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 636712Protein Adenylylsulfate reductase A subunit [68978] (1 species)
  7. 636713Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [68979] (2 PDB entries)
  8. 636716Domain d1jnza1: 1jnz A:503-643 [71766]
    Other proteins in same PDB: d1jnza2, d1jnza3, d1jnzb_, d1jnzc2, d1jnzc3, d1jnzd_

Details for d1jnza1

PDB Entry: 1jnz (more details), 2.5 Å

PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (A:) adenylylsulfate reductase

SCOP Domain Sequences for d1jnza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnza1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa
rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd
aekdewtfekvpyvqviewsf

SCOP Domain Coordinates for d1jnza1:

Click to download the PDB-style file with coordinates for d1jnza1.
(The format of our PDB-style files is described here.)

Timeline for d1jnza1: