Lineage for d1jmrb2 (1jmr B:76-246)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195728Fold d.110: Profilin-like [55769] (6 superfamilies)
  4. 195770Superfamily d.110.2: GAF domain-like [55781] (2 families) (S)
  5. 195776Family d.110.2.2: Thanscriptional regulator IclR, C-terminal domain [75513] (1 protein)
  6. 195777Protein Thanscriptional regulator IclR, C-terminal domain [75514] (1 species)
  7. 195778Species Thermotoga maritima [TaxId:243274] [75515] (1 PDB entry)
  8. 195780Domain d1jmrb2: 1jmr B:76-246 [71753]
    Other proteins in same PDB: d1jmra1, d1jmrb1

Details for d1jmrb2

PDB Entry: 1jmr (more details), 2.2 Å

PDB Description: Crystal Structure of the Thermotoga maritima IclR

SCOP Domain Sequences for d1jmrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmrb2 d.110.2.2 (B:76-246) Thanscriptional regulator IclR, C-terminal domain {Thermotoga maritima}
nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas
gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim
cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy

SCOP Domain Coordinates for d1jmrb2:

Click to download the PDB-style file with coordinates for d1jmrb2.
(The format of our PDB-style files is described here.)

Timeline for d1jmrb2:

  • d1jmrb2 is new in SCOP 1.61
  • d1jmrb2 became obsolete in SCOP 1.63

View in 3D
Domains from same chain:
(mouse over for more information)
d1jmrb1