Lineage for d1jmrb1 (1jmr B:0-75)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150451Family a.4.5.33: Thanscriptional regulator IclR, N-terminal domain [74676] (1 protein)
  6. 150452Protein Thanscriptional regulator IclR, N-terminal domain [74677] (1 species)
  7. 150453Species Thermotoga maritima [TaxId:243274] [74678] (1 PDB entry)
  8. 150455Domain d1jmrb1: 1jmr B:0-75 [71752]
    Other proteins in same PDB: d1jmra2, d1jmrb2

Details for d1jmrb1

PDB Entry: 1jmr (more details), 2.2 Å

PDB Description: Crystal Structure of the Thermotoga maritima IclR

SCOP Domain Sequences for d1jmrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmrb1 a.4.5.33 (B:0-75) Thanscriptional regulator IclR, N-terminal domain {Thermotoga maritima}
hmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryv
pgyklieygsfvlrrf

SCOP Domain Coordinates for d1jmrb1:

Click to download the PDB-style file with coordinates for d1jmrb1.
(The format of our PDB-style files is described here.)

Timeline for d1jmrb1:

  • d1jmrb1 is new in SCOP 1.61
  • d1jmrb1 became obsolete in SCOP 1.63

View in 3D
Domains from same chain:
(mouse over for more information)
d1jmrb2