Lineage for d1jm4b_ (1jm4 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152073Fold a.29: Bromodomain-like [47363] (4 superfamilies)
  4. 152074Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 152075Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 152084Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 152085Species Human (Homo sapiens) [TaxId:9606] [47376] (2 PDB entries)
  8. 152086Domain d1jm4b_: 1jm4 B: [71746]

Details for d1jm4b_

PDB Entry: 1jm4 (more details)

PDB Description: NMR Structure of P/CAF Bromodomain in Complex with HIV-1 Tat Peptide

SCOP Domain Sequences for d1jm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm4b_ a.29.2.1 (B:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens)}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOP Domain Coordinates for d1jm4b_:

Click to download the PDB-style file with coordinates for d1jm4b_.
(The format of our PDB-style files is described here.)

Timeline for d1jm4b_: