Lineage for d1jm1a_ (1jm1 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227477Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 227478Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 227479Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins)
  6. 227506Protein Rieske protein II (SoxF) [74918] (1 species)
  7. 227507Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [74919] (1 PDB entry)
  8. 227508Domain d1jm1a_: 1jm1 A: [71745]
    complexed with fes, mg

Details for d1jm1a_

PDB Entry: 1jm1 (more details), 1.11 Å

PDB Description: Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius

SCOP Domain Sequences for d1jm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius}
ntdglagfprykvaniqqvqqqikssgcavyffaypltdepcflvdlqaltgqqiteipn
pyygkyagplgqiqtikgvgpngtifafsdvcvhlgcqlpaqvivssesdpglyakgadl
hcpchgsiyalkdggvvvsgpaprplpivildydsstgdiyavgtnapyfsagiprttpq
dnllydprysysvpnnpscsng

SCOP Domain Coordinates for d1jm1a_:

Click to download the PDB-style file with coordinates for d1jm1a_.
(The format of our PDB-style files is described here.)

Timeline for d1jm1a_: