SCOPe 2.05: Domain d1jlwb2: 1jlw B:1-90

Lineage for d1jlwb2 (1jlw B:1-90)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class delta GST [81366] (6 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [75235] (1 PDB entry)

8. Domain d1jlwb2: 1jlw B:1-90 [71744]
   Other proteins in same PDB: d1jlwa1, d1jlwb1

Details for d1jlwb2

PDB Entry: 1jlw, 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4

PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d1jlwb2:

Sequence; same for both SEQRES and ATOM records:

>d1jlwb2 c.47.1.5 (B:1-90) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Timeline for d1jlwb2:

• d1jlwb2 first appeared in SCOP 1.61
  
• d1jlwb2 appears in SCOPe 2.04
  
• d1jlwb2 appears in SCOPe 2.06
  
• d1jlwb2 appears in the current release, SCOPe 2.08