Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
Protein Class delta GST [81366] (2 species) formerly a part of class theta enzymes |
Species Insect (Anopheles dirus b), isozyme 1-4 [75235] (1 PDB entry) |
Domain d1jlwa2: 1jlw A:1-90 [71742] Other proteins in same PDB: d1jlwa1, d1jlwb1 |
PDB Entry: 1jlw (more details), 2.45 Å
SCOP Domain Sequences for d1jlwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlwa2 c.47.1.5 (A:1-90) Class delta GST {Insect (Anopheles dirus b), isozyme 1-4} mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg fvlwesraiqiylvekygahdadlaerlyp
Timeline for d1jlwa2: