Lineage for d1jlve1 (1jlv E:85-207)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153238Species Insect (Anopheles dirus b), isozyme 1-3 [74724] (1 PDB entry)
  8. 153243Domain d1jlve1: 1jlv E:85-207 [71737]
    Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2

Details for d1jlve1

PDB Entry: 1jlv (more details), 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3

SCOP Domain Sequences for d1jlve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlve1 a.45.1.1 (E:85-207) Glutathione S-transferase {Insect (Anopheles dirus b), isozyme 1-3}
kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh
kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr
kyf

SCOP Domain Coordinates for d1jlve1:

Click to download the PDB-style file with coordinates for d1jlve1.
(The format of our PDB-style files is described here.)

Timeline for d1jlve1: