Lineage for d1jlvd2 (1jlv D:1-84)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315566Protein Class delta GST [81366] (2 species)
    formerly a part of class theta enzymes
  7. 315567Species Insect (Anopheles dirus b), isozyme 1-3 [75234] (1 PDB entry)
  8. 315571Domain d1jlvd2: 1jlv D:1-84 [71736]
    Other proteins in same PDB: d1jlva1, d1jlvb1, d1jlvc1, d1jlvd1, d1jlve1, d1jlvf1

Details for d1jlvd2

PDB Entry: 1jlv (more details), 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3

SCOP Domain Sequences for d1jlvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlvd2 c.47.1.5 (D:1-84) Class delta GST {Insect (Anopheles dirus b), isozyme 1-3}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflkinpqhciptlvdngf
alwesraictylaekygkddklyp

SCOP Domain Coordinates for d1jlvd2:

Click to download the PDB-style file with coordinates for d1jlvd2.
(The format of our PDB-style files is described here.)

Timeline for d1jlvd2: