Class a: All alpha proteins [46456] (179 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class delta GST [81355] (2 species) formerly a part of class theta enzymes |
Species Insect (Anopheles dirus b), isozyme 1-3 [74724] (1 PDB entry) |
Domain d1jlvd1: 1jlv D:85-207 [71735] Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2 |
PDB Entry: 1jlv (more details), 1.75 Å
SCOP Domain Sequences for d1jlvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlvd1 a.45.1.1 (D:85-207) Class delta GST {Insect (Anopheles dirus b), isozyme 1-3} kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr kyf
Timeline for d1jlvd1: