SCOP 1.63: Domain d1jlvc2: 1jlv C:1-84

Lineage for d1jlvc2 (1jlv C:1-84)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class delta GST [81366] (2 species)
   formerly a part of class theta enzymes

7. Species Insect (Anopheles dirus b), isozyme 1-3 [75234] (1 PDB entry)

8. Domain d1jlvc2: 1jlv C:1-84 [71734]
   Other proteins in same PDB: d1jlva1, d1jlvb1, d1jlvc1, d1jlvd1, d1jlve1, d1jlvf1

Details for d1jlvc2

PDB Entry: 1jlv, 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3

SCOP Domain Sequences for d1jlvc2:

Sequence; same for both SEQRES and ATOM records:

>d1jlvc2 c.47.1.5 (C:1-84) Class delta GST {Insect (Anopheles dirus b), isozyme 1-3}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflkinpqhciptlvdngf
alwesraictylaekygkddklyp

Timeline for d1jlvc2:

• d1jlvc2 first appeared in SCOP 1.61
  
• d1jlvc2 appears in SCOP 1.65
  
• d1jlvc2 appears in the current release, SCOPe 2.08