Lineage for d1jlvb1 (1jlv B:85-207)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356086Protein Class delta GST [81355] (5 species)
    formerly a part of class theta enzymes
  7. 356090Species Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId:123217] [74724] (1 PDB entry)
  8. 356092Domain d1jlvb1: 1jlv B:85-207 [71731]
    Other proteins in same PDB: d1jlva2, d1jlvb2, d1jlvc2, d1jlvd2, d1jlve2, d1jlvf2

Details for d1jlvb1

PDB Entry: 1jlv (more details), 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3

SCOP Domain Sequences for d1jlvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlvb1 a.45.1.1 (B:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3}
kdpqkravvnqrlyfdmgtlyqrfadyyypqifakqpanaenekkmkdavdflntfldgh
kyvagdsltiadltvlatvstydvagfelakyphvaawyertrkeapgaaineagieefr
kyf

SCOP Domain Coordinates for d1jlvb1:

Click to download the PDB-style file with coordinates for d1jlvb1.
(The format of our PDB-style files is described here.)

Timeline for d1jlvb1: