Lineage for d1jl7a_ (1jl7 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148271Protein Glycera globin [46467] (1 species)
  7. 148272Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 148273Domain d1jl7a_: 1jl7 A: [71726]

Details for d1jl7a_

PDB Entry: 1jl7 (more details), 1.4 Å

PDB Description: Crystal Structure Of CN-Ligated Component III Glycera Dibranchiata Monomeric Hemoglobin

SCOP Domain Sequences for d1jl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata)}
glsaaqrqvvastwkdiagadngagvgkeclskfisahpemaavfgfsgasdpgvaelga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaaygdisgalisglqs

SCOP Domain Coordinates for d1jl7a_:

Click to download the PDB-style file with coordinates for d1jl7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jl7a_: