Lineage for d1jkvd_ (1jkv D:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151635Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 151644Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 151645Species Lactobacillus plantarum [TaxId:1590] [74707] (2 PDB entries)
  8. 151649Domain d1jkvd_: 1jkv D: [71722]

Details for d1jkvd_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide

SCOP Domain Sequences for d1jkvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkvd_ a.25.1.2 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkvd_:

Click to download the PDB-style file with coordinates for d1jkvd_.
(The format of our PDB-style files is described here.)

Timeline for d1jkvd_: