Lineage for d1jkvb_ (1jkv B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212346Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 212347Species Lactobacillus plantarum [TaxId:1590] [74707] (2 PDB entries)
  8. 212349Domain d1jkvb_: 1jkv B: [71720]

Details for d1jkvb_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide

SCOP Domain Sequences for d1jkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkvb_ a.25.1.2 (B:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkvb_:

Click to download the PDB-style file with coordinates for d1jkvb_.
(The format of our PDB-style files is described here.)

Timeline for d1jkvb_: