Lineage for d1jktb_ (1jkt B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434528Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1434529Species Human (Homo sapiens) [TaxId:9606] [75561] (6 PDB entries)
    Uniprot P53355 2-285
  8. 1434536Domain d1jktb_: 1jkt B: [71712]

Details for d1jktb_

PDB Entry: 1jkt (more details), 3.5 Å

PDB Description: tetragonal crystal form of a catalytic domain of death-associated protein kinase
PDB Compounds: (B:) death-associated protein kinase

SCOPe Domain Sequences for d1jktb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jktb_ d.144.1.7 (B:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d1jktb_:

Click to download the PDB-style file with coordinates for d1jktb_.
(The format of our PDB-style files is described here.)

Timeline for d1jktb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jkta_