Lineage for d1jkta_ (1jkt A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512268Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 512269Species Human (Homo sapiens) [TaxId:9606] [75561] (6 PDB entries)
  8. 512275Domain d1jkta_: 1jkt A: [71711]

Details for d1jkta_

PDB Entry: 1jkt (more details), 3.49 Å

PDB Description: tetragonal crystal form of a catalytic domain of death-associated protein kinase

SCOP Domain Sequences for d1jkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkta_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens)}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOP Domain Coordinates for d1jkta_:

Click to download the PDB-style file with coordinates for d1jkta_.
(The format of our PDB-style files is described here.)

Timeline for d1jkta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jktb_