SCOP 1.71: Domain d1jkfb2: 1jkf B:323-437

Lineage for d1jkfb2 (1jkf B:323-437)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Myo-inositol 1-phosphate synthase [75484] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)

8. Domain d1jkfb2: 1jkf B:323-437 [71703]
   Other proteins in same PDB: d1jkfa1, d1jkfb1
   complexed with nad

Details for d1jkfb2

PDB Entry: 1jkf, 2.4 Å

PDB Description: holo 1l-myo-inositol-1-phosphate synthase

SCOP Domain Sequences for d1jkfb2:

Sequence, based on SEQRES records:

>d1jkfb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records):

>d1jkfb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhskvamdeyyselmlgghnrisihnvce

Timeline for d1jkfb2:

• d1jkfb2 first appeared in SCOP 1.61
  
• d1jkfb2 appears in SCOP 1.69
  
• d1jkfb2 appears in SCOP 1.73
  
• d1jkfb2 appears in the current release, SCOPe 2.08