Lineage for d1jjga_ (1jjg A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins) 
Protein Viral structural mimic of eIF2alpha [74952] (2 species) 
Species Myxoma virus, m156r [TaxId:10273] [74954] (1 PDB entry) 
Domain d1jjga_: 1jjg A: [71696]
Details for d1jjga_
PDB Entry: 1jjg (more details)
PDB Description: solution structure of myxoma virus protein m156r
SCOP Domain Sequences for d1jjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r}
mtvikpssrprprknknikvntyrtsamdlspgsvhegivyfkdgifkvrllgyegheci
lldylnyrqdtldrlkerlvgrviktrvvradglyvdlrrff
SCOP Domain Coordinates for d1jjga_:
Click to download the PDB-style file with coordinates for d1jjga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jjga_:
- d1jjga_ is new in SCOP 1.61
- d1jjga_ appears in SCOP 1.63
- d1jjga_ appears in the current release, SCOPe 2.08
View in 3D