Lineage for d1jizb_ (1jiz B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918096Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1918097Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1918145Domain d1jizb_: 1jiz B: [71694]
    complexed with ca, cgs, zn

Details for d1jizb_

PDB Entry: 1jiz (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of human Macrophage Elastase MMP-12
PDB Compounds: (B:) macrophage elastase MMP-12

SCOPe Domain Sequences for d1jizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jizb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gfrempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmad
ilvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavh
eighslglghssdpkavmfptykyvdintfrlsaddirgiqslygd

SCOPe Domain Coordinates for d1jizb_:

Click to download the PDB-style file with coordinates for d1jizb_.
(The format of our PDB-style files is described here.)

Timeline for d1jizb_: