SCOP 1.63: Domain d1jigb_: 1jig B:

Lineage for d1jigb_ (1jig B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Dodecameric ferritin homolog [47250] (5 species)

7. Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry)

8. Domain d1jigb_: 1jig B: [71686]

Details for d1jigb_

PDB Entry: 1jig, 1.46 Å

PDB Description: Dlp-2 from Bacillus anthracis

SCOP Domain Sequences for d1jigb_:

Sequence; same for both SEQRES and ATOM records:

>d1jigb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2}
stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
atsadmllaihttleqhvwmlsaflk

Timeline for d1jigb_:

• d1jigb_ first appeared in SCOP 1.61
  
• d1jigb_ appears in SCOP 1.65
  
• d1jigb_ appears in the current release, SCOPe 2.08